Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macroscelides proboscideus Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Macroscelides proboscideus Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O19025

Expression Region

1-387

Origin

Macroscelides proboscideus (Short-eared elephant shrew)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRHTWCXVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCII LTVWLIAAAISLPPLIYKGDQDPQPRGRPQCKLNQEAWYILSSSIGSFFVPCLIMILVYL RIYLIAKRSSSRRKPRAKGXPREGESKQPQLRPVGTSVSARPPALTSPLAVTGEANGHSK PTGERETPEDLVSPASPPSWPAIPNSGQGRKEGVCGTSPEEEAEEEEECGPEAVPASPAL ACSPSLQPPQGSRVLATLRGQVLLGRGVGTARGQWWRRRAQLTREKRFTFVLAVVIGVFV LCWFPFFFSYSLGAICPQHCKVPHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3Beta)-3,25-Dihydroxycholest-5-en-7-one
TRC-D452805-5MG 5 mg

(3Beta)-3,25-Dihydroxycholest-5-en-7-one

Sign In for Pricing
View Details
Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852M1-01 20 Tests

Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852M1-02 100 Tests

Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852M1-03 2x 100 Tests

Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
CYCS Antibody
KC-45002-01 50 μL

CYCS Antibody

Sign In for Pricing
View Details
CYCS Antibody
KC-45002-02 100 µL

CYCS Antibody

Sign In for Pricing
View Details