Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macroscelides proboscideus Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Macroscelides proboscideus Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O19025

Expression Region

1-387

Origin

Macroscelides proboscideus (Short-eared elephant shrew)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRHTWCXVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCII LTVWLIAAAISLPPLIYKGDQDPQPRGRPQCKLNQEAWYILSSSIGSFFVPCLIMILVYL RIYLIAKRSSSRRKPRAKGXPREGESKQPQLRPVGTSVSARPPALTSPLAVTGEANGHSK PTGERETPEDLVSPASPPSWPAIPNSGQGRKEGVCGTSPEEEAEEEEECGPEAVPASPAL ACSPSLQPPQGSRVLATLRGQVLLGRGVGTARGQWWRRRAQLTREKRFTFVLAVVIGVFV LCWFPFFFSYSLGAICPQHCKVPHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diisopropyl Malonate
TRC-D459390-1G 1 g

Diisopropyl Malonate

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF740 conjugate, 0.1mg/mL
BNC741729-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Papillary renal cell carcinoma (PRCC) Mouse Monoclonal Antibody [Clone ID: OTI5H7]
CF812966 100 µg

Papillary renal cell carcinoma (PRCC) Mouse Monoclonal Antibody [Clone ID: OTI5H7]

Sign In for Pricing
View Details
3,3',5-Triiodo Thyroacetic Acid
TRC-T795320-250MG 250 mg

3,3',5-Triiodo Thyroacetic Acid

Sign In for Pricing
View Details
Agfg1 Mouse Gene Knockout Kit (CRISPR)
KN500974 1 Kit

Agfg1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(±)-Perillyl Alcohol (>90%)
TRC-P835188-250MG 250 mg

(±)-Perillyl Alcohol (>90%)

Sign In for Pricing
View Details