Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macroscelides proboscideus Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Macroscelides proboscideus Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O19025

Expression Region

1-387

Origin

Macroscelides proboscideus (Short-eared elephant shrew)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRHTWCXVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCII LTVWLIAAAISLPPLIYKGDQDPQPRGRPQCKLNQEAWYILSSSIGSFFVPCLIMILVYL RIYLIAKRSSSRRKPRAKGXPREGESKQPQLRPVGTSVSARPPALTSPLAVTGEANGHSK PTGERETPEDLVSPASPPSWPAIPNSGQGRKEGVCGTSPEEEAEEEEECGPEAVPASPAL ACSPSLQPPQGSRVLATLRGQVLLGRGVGTARGQWWRRRAQLTREKRFTFVLAVVIGVFV LCWFPFFFSYSLGAICPQHCKVPHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human sTNF RI Recombinant Rabbit monoclonal Antibody
HA723159 100 µL

Human sTNF RI Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Manganese(IV) Oxide
TRC-M164310-25G 25 g

Manganese(IV) Oxide

Sign In for Pricing
View Details
PMS2 Recombinant Rabbit Monoclonal Antibody [SY08-09]
ET1605-1 100 µL

PMS2 Recombinant Rabbit Monoclonal Antibody [SY08-09]

Sign In for Pricing
View Details
4-Amino-4'-chlorodiphenyl Sulfone
TRC-A603775-1G 1 g

4-Amino-4'-chlorodiphenyl Sulfone

Sign In for Pricing
View Details
ZNF740 (NM_001004304) Human Over-expression Lysate
LC424081 20 µg

ZNF740 (NM_001004304) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TRAF3, C-His Tag
HA210601-01 20 µg

Human TRAF3, C-His Tag

Sign In for Pricing
View Details