Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 4 (Htr4)

This Recombinant Mouse 5-hydroxytryptamine receptor 4 (Htr4) spans the amino acid sequence from region 1-388.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 4, 5-HT-4, 5-HT4, Serotonin receptor 4

UniProt

P97288

Expression Region

1-388

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV SLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSN STWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRP QPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEQVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRD TVECGGQWESRCHLTATSPLVAAQPSDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTL Mouse Monoclonal Antibody [Clone ID: OTI3G5]
TA502027 100 µL

TTL Mouse Monoclonal Antibody [Clone ID: OTI3G5]

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Antiholin-like protein LrgA (lrgA), partial
MBS7061739 Inquire

Recombinant Staphylococcus aureus Antiholin-like protein LrgA (lrgA), partial

Sign In for Pricing
View Details
Reep2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4189707 1.0 µg DNA

Reep2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human Galectin 9 (GAL9), Active Protein
RPU54889-01 50 µg

Human Galectin 9 (GAL9), Active Protein

Sign In for Pricing
View Details
Human Galectin 9 (GAL9), Active Protein
RPU54889-02 100 µg

Human Galectin 9 (GAL9), Active Protein

Sign In for Pricing
View Details
Human Galectin 9 (GAL9), Active Protein
RPU54889-03 1 mg

Human Galectin 9 (GAL9), Active Protein

Sign In for Pricing
View Details