Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 4 (Htr4)

This Recombinant Mouse 5-hydroxytryptamine receptor 4 (Htr4) spans the amino acid sequence from region 1-388.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 4, 5-HT-4, 5-HT4, Serotonin receptor 4

UniProt

P97288

Expression Region

1-388

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV SLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSN STWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRP QPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEQVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRD TVECGGQWESRCHLTATSPLVAAQPSDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT7 Antibody
orb519549-01 50 μL

SYT7 Antibody

Sign In for Pricing
View Details
SYT7 Antibody
orb519549-02 100 µL

SYT7 Antibody

Sign In for Pricing
View Details
Human LBR Knockout A549 cell line
GTR15419683 1 Vial

Human LBR Knockout A549 cell line

Sign In for Pricing
View Details
P/P043/NT/PE-DIA200-1 Prohibited Activity Signs & Labels (Adhesive)
198159 1 Pack (1 Panel (s) x 1 Pack)

P/P043/NT/PE-DIA200-1 Prohibited Activity Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Uncharacterized protein C6orf141 (C6orf141) Human ELISA Kit
I1095 96 Tests

Uncharacterized protein C6orf141 (C6orf141) Human ELISA Kit

Sign In for Pricing
View Details
EIF2AK4/GCN2 Rabbit Polyclonal Antibody (BF488)
orb2434957 100 µL

EIF2AK4/GCN2 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details