Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Somatostatin receptor type 4 (SSTR4)

This Recombinant Human Somatostatin receptor type 4 (SSTR4) spans the amino acid sequence from region 1-388.

Product Specifications

Product Name Alternative

Somatostatin receptor type 4, SS-4-R, SS4-R, SS4R

UniProt

P31391

Expression Region

1-388

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM CPPLPCQQEALQPEPGRKRIPLTRTTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A2bp1 3'UTR Luciferase Stable Cell Line
TU200005 1.0 mL

A2bp1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse monoclonal antibody Anti-Human E2F5
MBS120364-01 0.1 mg

Mouse monoclonal antibody Anti-Human E2F5

Sign In for Pricing
View Details
Mouse monoclonal antibody Anti-Human E2F5
MBS120364-02 5x 0.1 mg

Mouse monoclonal antibody Anti-Human E2F5

Sign In for Pricing
View Details
Rabbit Anti-TAB1 antibody
SL4135R-01 50 µL

Rabbit Anti-TAB1 antibody

Sign In for Pricing
View Details
Rabbit Anti-TAB1 antibody
SL4135R-02 100 µL

Rabbit Anti-TAB1 antibody

Sign In for Pricing
View Details
Goat anti Monkey IgM (Texas Red)
MBS538739-01 1 mg

Goat anti Monkey IgM (Texas Red)

Sign In for Pricing
View Details