Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Somatostatin receptor type 4 (SSTR4)

This Recombinant Human Somatostatin receptor type 4 (SSTR4) spans the amino acid sequence from region 1-388.

Product Specifications

Product Name Alternative

Somatostatin receptor type 4, SS-4-R, SS4-R, SS4R

UniProt

P31391

Expression Region

1-388

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM CPPLPCQQEALQPEPGRKRIPLTRTTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Mouse Anti-Human IgG (H+L)
E-AB-1171-01 120 µL

FITC-Mouse Anti-Human IgG (H+L)

Sign In for Pricing
View Details
FITC-Mouse Anti-Human IgG (H+L)
E-AB-1171-02 500 µL

FITC-Mouse Anti-Human IgG (H+L)

Sign In for Pricing
View Details
FITC-Mouse Anti-Human IgG (H+L)
E-AB-1171-03 1 mL

FITC-Mouse Anti-Human IgG (H+L)

Sign In for Pricing
View Details
Anti-TRPC3 Antibody Picoband® Fluoro647 Conjugated
A01472-Fluoro647 100 µg/Vial

Anti-TRPC3 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Vibrio cholerae serotype O1 higB-2 Camelus Monoclonal Antibody
orb2959481-01 50 µg

Vibrio cholerae serotype O1 higB-2 Camelus Monoclonal Antibody

Sign In for Pricing
View Details
Vibrio cholerae serotype O1 higB-2 Camelus Monoclonal Antibody
orb2959481-02 100 µg

Vibrio cholerae serotype O1 higB-2 Camelus Monoclonal Antibody

Sign In for Pricing
View Details