Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Oxytocin receptor (Oxtr)

This Recombinant Mouse Oxytocin receptor (Oxtr) spans the amino acid sequence from region 1-388.

Product Specifications

Product Name Alternative

Oxytocin receptor, OT-R

UniProt

P97926

Expression Region

1-388

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGTPAANWSIELDLGSGVPPGAEGNLTAGPPRRNEALARVEVAVLCLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASVPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA AAEGSDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSARYLKGSRPGETS ISKKSNSSTFVLSRCSSSQRSCSQPSSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RA (PTPRC/1131), CF640R conjugate, 0.1mg/mL
BNC401131-500 1x 500 µL

CD45RA (PTPRC/1131), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF594 conjugate, 0.1mg/mL
BNC940693-500 1x 500 µL

CD56 / NCAM (123C3.D5 + 123A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRPS11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]
TA802879AM 100 µL

MRPS11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]

Sign In for Pricing
View Details
SH2D4B (NM_001145719) Human Over-expression Lysate
LC428983 20 µg

SH2D4B (NM_001145719) Human Over-expression Lysate

Sign In for Pricing
View Details
HSPA2 Antibody
KC-18987-01 50 μL

HSPA2 Antibody

Sign In for Pricing
View Details
HSPA2 Antibody
KC-18987-02 100 µL

HSPA2 Antibody

Sign In for Pricing
View Details