Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukotriene B4 receptor 2 (LTB4R2)

This Recombinant Human Leukotriene B4 receptor 2 (LTB4R2) spans the amino acid sequence from region 1-389.

Product Specifications

Product Name Alternative

Leukotriene B4 receptor 2, LTB4-R 2, LTB4-R2, LTB4 receptor JULF2, Leukotriene B4 receptor BLT2, Seven transmembrane receptor BLTR2

UniProt

Q9NPC1

Expression Region

1-389

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT TPQLKVVGQGRGNGDPGGGMEKDGPEWDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dengue virus type 2 Genome polyprotein (Q1642N), partial
orb1881885-01 20 µg

Recombinant Dengue virus type 2 Genome polyprotein (Q1642N), partial

Sign In for Pricing
View Details
Recombinant Dengue virus type 2 Genome polyprotein (Q1642N), partial
orb1881885-02 100 µg

Recombinant Dengue virus type 2 Genome polyprotein (Q1642N), partial

Sign In for Pricing
View Details
Recombinant Dengue virus type 2 Genome polyprotein (Q1642N), partial
orb1881885-03 1 mg

Recombinant Dengue virus type 2 Genome polyprotein (Q1642N), partial

Sign In for Pricing
View Details
PRL3 Rabbit Polyclonal Antibody
orb412054-01 30 µL

PRL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRL3 Rabbit Polyclonal Antibody
orb412054-02 50 μL

PRL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRL3 Rabbit Polyclonal Antibody
orb412054-03 100 µL

PRL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details