Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bufo marinus Mesotocin receptor

This Recombinant Bufo marinus Mesotocin receptor spans the amino acid sequence from region 1-389.

Product Specifications

Product Name Alternative

Mesotocin receptor, MTR

UniProt

Q90252

Expression Region

1-389

Origin

Bufo marinus (Giant toad) (Cane toad)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGLCLNLDCSELPNSSWVNSSMENQNHSSNSTRDPLKRNEEVAKVEVTVLALILFLALA GNICVLLGIYINRHKHSRMYFFMKHLSIADLVVAIFQVLPQLIWDITFRFYAPDLVCRLV TYLQVVGMFASTYMLLLMSLDRCLAICQPLRSLHRRSDCVYVLFTWILSFLLSTPQTVIF SLTEVGNGVYDCRADFIQPWGPKAYITWITLAVYIIPVMILSVCYGLISYKIWQNIRLKT VCESNLRLSTSRRATLSRVSSVRLISKAKIRTVKMTFIIVLAYIVCWTPFFFVQMWSVWD PNPPKEASLFIIAMLLGSLNSCCNPWIYMLFTGHLFHDLLQSFLCCSARYLKTQQQGSDL SASRKSNSSTFVLSRKSSSQKSITQPSTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HOXC4 Matched Antibody Pair Set [Poly/RD1110]
Z01LS-1122-LS107 5 Plates

Human HOXC4 Matched Antibody Pair Set [Poly/RD1110]

Sign In for Pricing
View Details
TXNIP Rabbit Polyclonal Antibody (N-term)
E28PB1982 100 µL

TXNIP Rabbit Polyclonal Antibody (N-term)

Sign In for Pricing
View Details
Recombinant Brucella abortus Adenine deaminase (ade), partial
MBS1426863 Inquire

Recombinant Brucella abortus Adenine deaminase (ade), partial

Sign In for Pricing
View Details
Mouse Monoclonal TPX2 Antibody (TPX2-01) [DyLight 350]
NBP2-67265UV 0.1 mL

Mouse Monoclonal TPX2 Antibody (TPX2-01) [DyLight 350]

Sign In for Pricing
View Details
Human ARL4A qPCR Primer Pair
QH30561S 200 Tests

Human ARL4A qPCR Primer Pair

Sign In for Pricing
View Details
Ctnnd1 ORF Vector (Mouse) (pORF)
ORF042198 1.0 µg DNA

Ctnnd1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details