Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Dog 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-389.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, 5-HTR1B, 5-HT1D subtype beta, Serotonin receptor 1B

UniProt

P79250

Expression Region

1-389

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAAGAPCAPPPPAGSQTGAPPANLSSAPHNCSAEGYIYQDSVALPWKVLLVILLALITL ATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVV CDLWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISIS LPPFFWRQAKAEEEVSDCVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILK QTPNRTGKRLTRAQLITDSPGSTSSVTSVNSRAPDVPSESGSPVYVNQVKVRVSDALLEK KKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLN SLINPIIYTMSNEDFKQAFHKLIRFKCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dienestrol(p-OH) (HRP)
MBS6027358-01 0.5 mL

Dienestrol(p-OH) (HRP)

Sign In for Pricing
View Details
Dienestrol(p-OH) (HRP)
MBS6027358-02 5x 0.5 mL

Dienestrol(p-OH) (HRP)

Sign In for Pricing
View Details
B4GT4 Polyclonal Antibody
JOT-AP06640-01 20 µL

B4GT4 Polyclonal Antibody

Sign In for Pricing
View Details
B4GT4 Polyclonal Antibody
JOT-AP06640-02 50 μL

B4GT4 Polyclonal Antibody

Sign In for Pricing
View Details
B4GT4 Polyclonal Antibody
JOT-AP06640-03 100 µL

B4GT4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Lipoma-preferred partner LPP Antibody Picoband® Fluoro647 Conjugated
PA2040-Fluoro647 100 µg/Vial

Anti-Lipoma-preferred partner LPP Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details