Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteinase-activated receptor 1 (F2r)

This Recombinant Mouse Proteinase-activated receptor 1 (F2r) spans the amino acid sequence from region 42-430.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 1, PAR-1, Thrombin receptor

UniProt

P30558

Expression Region

42-430

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFFLRNPSENTFELVPLGDEEEEEKNESVLLEGRAVYLNISLPPHTPPPPFISEDASGYL TSPWLTLFMPSVYTIVFIVSLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVLP FKISYYFSGTDWQFGSGMCRFATAAFYGNMYASIMLMTVISIDRFLAVVYPIQSLSWRTL GRANFTCVVIWVMAIMGVVPLLLKEQTTRVPGLNITTCHDVLSENLMQGFYSYYFSAFSA IFFLVPLIVSTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVH YLFLSDSPGTEAAYFAYLLCVCVSSVSCCIDPLIYYYASSECQRHLYSILCCKESSDPNS CNSTGQLMPSKMDTCSSHLNNSIYKKLLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM157B Human Gene Knockout Kit (CRISPR)
KN427199 1 Kit

FAM157B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ASH2L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]
TA810988BM 100 µL

ASH2L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]

Sign In for Pricing
View Details
MAP2K3 (Ab-222) Antibody
8B8139-AAT 50 µg

MAP2K3 (Ab-222) Antibody

Sign In for Pricing
View Details
Fenbendazole Sulfoxide-d3
TRC-F246792-2.5MG 2.5 mg

Fenbendazole Sulfoxide-d3

Sign In for Pricing
View Details
2R,3S-Dihydroxy-4-oxo-butanoic Acid (>80%)
TRC-D450800-10MG 10 mg

2R,3S-Dihydroxy-4-oxo-butanoic Acid (>80%)

Sign In for Pricing
View Details
Amy2b Mouse Gene Knockout Kit (CRISPR)
KN501215 1 Kit

Amy2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details