Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteinase-activated receptor 1 (F2r)

This Recombinant Mouse Proteinase-activated receptor 1 (F2r) spans the amino acid sequence from region 42-430.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 1, PAR-1, Thrombin receptor

UniProt

P30558

Expression Region

42-430

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFFLRNPSENTFELVPLGDEEEEEKNESVLLEGRAVYLNISLPPHTPPPPFISEDASGYL TSPWLTLFMPSVYTIVFIVSLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVLP FKISYYFSGTDWQFGSGMCRFATAAFYGNMYASIMLMTVISIDRFLAVVYPIQSLSWRTL GRANFTCVVIWVMAIMGVVPLLLKEQTTRVPGLNITTCHDVLSENLMQGFYSYYFSAFSA IFFLVPLIVSTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVH YLFLSDSPGTEAAYFAYLLCVCVSSVSCCIDPLIYYYASSECQRHLYSILCCKESSDPNS CNSTGQLMPSKMDTCSSHLNNSIYKKLLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

21-Deacetoxy Deflazacort-3,20-hydrazinecarboxamide
TRC-D198040-1MG 1 mg

21-Deacetoxy Deflazacort-3,20-hydrazinecarboxamide

Sign In for Pricing
View Details
Securin (PTTG1) Rabbit Polyclonal Antibody
AP06655PU-N 100 µg

Securin (PTTG1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Perfluorododecyl Iodide
TRC-P353280-1MG 1 mg

Perfluorododecyl Iodide

Sign In for Pricing
View Details
CTP synthase (CTPS1) Human Gene Knockout Kit (CRISPR)
KN202434LP 1 Kit

CTP synthase (CTPS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MARK3 Rabbit Polyclonal Antibody
TA368096 100 µL

MARK3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RBCK1 Human Gene Knockout Kit (CRISPR)
KN203906 1 Kit

RBCK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details