Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteinase-activated receptor 1 (F2r)

This Recombinant Mouse Proteinase-activated receptor 1 (F2r) spans the amino acid sequence from region 42-430.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 1, PAR-1, Thrombin receptor

UniProt

P30558

Expression Region

42-430

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFFLRNPSENTFELVPLGDEEEEEKNESVLLEGRAVYLNISLPPHTPPPPFISEDASGYL TSPWLTLFMPSVYTIVFIVSLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVLP FKISYYFSGTDWQFGSGMCRFATAAFYGNMYASIMLMTVISIDRFLAVVYPIQSLSWRTL GRANFTCVVIWVMAIMGVVPLLLKEQTTRVPGLNITTCHDVLSENLMQGFYSYYFSAFSA IFFLVPLIVSTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVH YLFLSDSPGTEAAYFAYLLCVCVSSVSCCIDPLIYYYASSECQRHLYSILCCKESSDPNS CNSTGQLMPSKMDTCSSHLNNSIYKKLLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atg7 Mouse Gene Knockout Kit (CRISPR)
KN301741BN 1 Kit

Atg7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit
E-EL-R0891-01 24 Tests

Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit

Sign In for Pricing
View Details
Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit
E-EL-R0891-02 48 Tests

Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit

Sign In for Pricing
View Details
Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit
E-EL-R0891-03 96 Tests

Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit

Sign In for Pricing
View Details
VWDE (NM_001135924) Human Over-expression Lysate
LC427732 20 µg

VWDE (NM_001135924) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIM29 Recombinant Rabbit monoclonal Antibody
HA750854 100 µL

TRIM29 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details