Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Horse 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin receptor 1B

UniProt

Q0EAB5

Expression Region

1-390

Origin

Equus caballus (Horse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEETGAQCAPPPPAGSQTGVSQVNLSAAPSHNCSTEGYVYQDSVALPWKVLLVVLLALIT LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYVVTGRWTLGQV VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI SLPPFFWRQAKAEEEVLDCLVNTDHILYTVYSTVGAFYFPTLLLIALYSRIYVEARSRIL KQTPNRTGKRLTRAQLMTDSPGSTSSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALVE KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL NSLINPIIYTMSNEDFKQAFHKLIRFKCAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (Trifluoromethyl) phenylacetic acid
291048-01 25 g

3- (Trifluoromethyl) phenylacetic acid

Sign In for Pricing
View Details
3- (Trifluoromethyl) phenylacetic acid
291048-02 50 g

3- (Trifluoromethyl) phenylacetic acid

Sign In for Pricing
View Details
3- (Trifluoromethyl) phenylacetic acid
291048-03 100 g

3- (Trifluoromethyl) phenylacetic acid

Sign In for Pricing
View Details
AIM2 Rabbit Polyclonal Antibody (BF680)
orb1594459 100 µL

AIM2 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
TATDN1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
46214061 1.0 µg DNA

TATDN1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
VWCE Rabbit Polyclonal Antibody (APC)
orb994677 100 µL

VWCE Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details