Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histamine H4 receptor (HRH4)

This Recombinant Human Histamine H4 receptor (HRH4) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

Histamine H4 receptor, H4R, HH4R, AXOR35, G-protein coupled receptor 105, GPRv53, Pfi-013, SP9144

UniProt

Q9H3N8

Expression Region

1-390

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha 1 microglobulin (AMBP) Human Knockdown Lysate
LY300034 100 µg

Alpha 1 microglobulin (AMBP) Human Knockdown Lysate

Sign In for Pricing
View Details
Human BUD13 activation kit by CRISPRa
GA113701 1 Kit

Human BUD13 activation kit by CRISPRa

Sign In for Pricing
View Details
BIVM Human Gene Knockout Kit (CRISPR)
KN423523 1 Kit

BIVM Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF405S conjugate, 0.1mg/mL
BNC041317-100 1x 100 µL

Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Hic2 activation kit by CRISPRa
GA206250 1 Kit

Mouse Hic2 activation kit by CRISPRa

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF647 conjugate, 0.1mg/mL
BNC472602-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details