Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Gorilla gorilla gorilla 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin receptor 1B

UniProt

Q9N2B7

Expression Region

1-390

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEPGAQCAPPXPAGSETWVPQANLSSAPSQNCSAKDYIYQDSIALPWKVLLVMLLALIT LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL NSLINPIIYTMSNEDFKQAFHKLIRFKCTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pfkp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
36436114 3x 1.0 µg

Pfkp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mitd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
30159114 3x 1.0 µg

Mitd1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Magneson Reagent
V0168 00125 125 mL

Magneson Reagent

Sign In for Pricing
View Details
Coproporphyrinogen III Oxidase Rabbit pAb, PE-Cy5.5 conjugated
orb2875876 100 µL

Coproporphyrinogen III Oxidase Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Recombinant Human TDRD7 Protein
E30P2522 20 µg

Recombinant Human TDRD7 Protein

Sign In for Pricing
View Details
FAM124B Antibody
E311260 200 µL

FAM124B Antibody

Sign In for Pricing
View Details