Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Gorilla gorilla gorilla 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin receptor 1B

UniProt

Q9N2B7

Expression Region

1-390

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEPGAQCAPPXPAGSETWVPQANLSSAPSQNCSAKDYIYQDSIALPWKVLLVMLLALIT LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL NSLINPIIYTMSNEDFKQAFHKLIRFKCTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Heph shRNA (UAS) - Lentiviral mouse Heph shRNA (UAS) (25)
GTR15215117 1 Vial

Lentiviral mouse Heph shRNA (UAS) - Lentiviral mouse Heph shRNA (UAS) (25)

Sign In for Pricing
View Details
TSSK2 (Testis-specific Serine/threonine-protein Kinase 2, TSSK-2, Testis-specific Kinase 2, TSK2, TSK-2, DiGeorge Syndrome Protein G, DGSG, DGS-G, Serine/threonine-protein Kinase 22B, STK22B, SPOGA2) (MaxLight 490)
MBS6203899-01 0.1 mL

TSSK2 (Testis-specific Serine/threonine-protein Kinase 2, TSSK-2, Testis-specific Kinase 2, TSK2, TSK-2, DiGeorge Syndrome Protein G, DGSG, DGS-G, Serine/threonine-protein Kinase 22B, STK22B, SPOGA2) (MaxLight 490)

Sign In for Pricing
View Details
TSSK2 (Testis-specific Serine/threonine-protein Kinase 2, TSSK-2, Testis-specific Kinase 2, TSK2, TSK-2, DiGeorge Syndrome Protein G, DGSG, DGS-G, Serine/threonine-protein Kinase 22B, STK22B, SPOGA2) (MaxLight 490)
MBS6203899-02 5x 0.1 mL

TSSK2 (Testis-specific Serine/threonine-protein Kinase 2, TSSK-2, Testis-specific Kinase 2, TSK2, TSK-2, DiGeorge Syndrome Protein G, DGSG, DGS-G, Serine/threonine-protein Kinase 22B, STK22B, SPOGA2) (MaxLight 490)

Sign In for Pricing
View Details
Pyridoxal Phosphate Binding Protein (PROSC) Antibody (Biotin)
abx304965-01 20 µg

Pyridoxal Phosphate Binding Protein (PROSC) Antibody (Biotin)

Sign In for Pricing
View Details
Pyridoxal Phosphate Binding Protein (PROSC) Antibody (Biotin)
abx304965-02 50 µg

Pyridoxal Phosphate Binding Protein (PROSC) Antibody (Biotin)

Sign In for Pricing
View Details
Pyridoxal Phosphate Binding Protein (PROSC) Antibody (Biotin)
abx304965-03 100 µg

Pyridoxal Phosphate Binding Protein (PROSC) Antibody (Biotin)

Sign In for Pricing
View Details