Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative odorant receptor 85b (Or85b)

This Recombinant Drosophila melanogaster Putative odorant receptor 85b (Or85b) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

Putative odorant receptor 85b

UniProt

Q9VHQ7

Expression Region

1-390

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLMKYASFFYTAVGIRPYTNGEESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFM DNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMY LGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDNW SYYPLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLSNSMERHELSGDWKKDSRF LVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKLFLFL VSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKAT IFLDITRSTMTDLLQISYKFFALLRTMYTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-100 1x 100 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF488A conjugate, 0.1mg/mL
BNC880012-500 1x 500 µL

Tyrosinase (T311), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-100 1x 100 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD62L (L-Selectin) (LAM1-116), CF405S conjugate, 0.1mg/mL
BNC041587-100 1x 100 µL

CD62L (L-Selectin) (LAM1-116), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF640R conjugate, 0.1mg/mL
BNC402616-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details