Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Rabbit 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin 1D beta receptor, 5-HT-1D-beta, Serotonin receptor 1B

UniProt

P49144

Expression Region

1-390

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEPGAQCAPPLAAGSQIAVPQANLSAAHSHNCSAEGYIYQDSIALPWKVLLVLLLALFT LATTLSNAFVVATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDLWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIRLVWVFSICI SLPPFFWRQAKAEEEVSECLVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTTSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGVFIVCWLPFFIISLVMPICKDACWFHQAIFDFFTWLGYV NSLINPIIYTMSNEDFKQAFHKLIRFKCTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit
MBS2612064-01 48 Well

Porcine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit

Sign In for Pricing
View Details
Porcine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit
MBS2612064-02 96 Well

Porcine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit

Sign In for Pricing
View Details
Porcine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit
MBS2612064-03 5x 96 Well

Porcine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit

Sign In for Pricing
View Details
Porcine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit
MBS2612064-04 10x 96 Well

Porcine purkinje cell autoantibody (PCA-1/Yo) ELISA Kit

Sign In for Pricing
View Details
RNF93 Rabbit pAb, Pacific Blue conjugated
orb2884027 100 µL

RNF93 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Catsperg1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
15096126 3x 1.0µg DNA

Catsperg1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details