Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Rabbit 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin 1D beta receptor, 5-HT-1D-beta, Serotonin receptor 1B

UniProt

P49144

Expression Region

1-390

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEPGAQCAPPLAAGSQIAVPQANLSAAHSHNCSAEGYIYQDSIALPWKVLLVLLLALFT LATTLSNAFVVATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDLWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIRLVWVFSICI SLPPFFWRQAKAEEEVSECLVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTTSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGVFIVCWLPFFIISLVMPICKDACWFHQAIFDFFTWLGYV NSLINPIIYTMSNEDFKQAFHKLIRFKCTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABR CRISPR Activation Plasmid (h)
sc-407250-ACT 20 µg

ABR CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Anti-HIPK4 Antibody Picoband®
A12886-1-carrier-free 100 µg/Vial

Anti-HIPK4 Antibody Picoband®

Sign In for Pricing
View Details
Mouse Cathelicidin Antimicrobial Peptide (CAMP) ELISA Kit
RDR-CAMP-Mu-01 96 Tests

Mouse Cathelicidin Antimicrobial Peptide (CAMP) ELISA Kit

Sign In for Pricing
View Details
Mouse Cathelicidin Antimicrobial Peptide (CAMP) ELISA Kit
RDR-CAMP-Mu-02 48 Tests

Mouse Cathelicidin Antimicrobial Peptide (CAMP) ELISA Kit

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor 121 (VEGF121)
TRV-0054104-01 10 µg

Recombinant Vascular Endothelial Growth Factor 121 (VEGF121)

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor 121 (VEGF121)
TRV-0054104-02 50 µg

Recombinant Vascular Endothelial Growth Factor 121 (VEGF121)

Sign In for Pricing
View Details