Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Rabbit 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin 1D beta receptor, 5-HT-1D-beta, Serotonin receptor 1B

UniProt

P49144

Expression Region

1-390

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEPGAQCAPPLAAGSQIAVPQANLSAAHSHNCSAEGYIYQDSIALPWKVLLVLLLALFT LATTLSNAFVVATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDLWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIRLVWVFSICI SLPPFFWRQAKAEEEVSECLVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTTSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGVFIVCWLPFFIISLVMPICKDACWFHQAIFDFFTWLGYV NSLINPIIYTMSNEDFKQAFHKLIRFKCTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ezrin (EZR) (NM_003379) Human Tagged ORF Clone Lentiviral Particle
RC200404L3V 200 µL

Ezrin (EZR) (NM_003379) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
BMP-8 Polyclonal Antibody
ABP56233-01 30 µL

BMP-8 Polyclonal Antibody

Sign In for Pricing
View Details
BMP-8 Polyclonal Antibody
ABP56233-02 100 µL

BMP-8 Polyclonal Antibody

Sign In for Pricing
View Details
BMP-8 Polyclonal Antibody
ABP56233-03 200 µL

BMP-8 Polyclonal Antibody

Sign In for Pricing
View Details
NGFR/p75NTR Protein, Human, Recombinant
TMPS-00109-01 5 µg

NGFR/p75NTR Protein, Human, Recombinant

Sign In for Pricing
View Details
NGFR/p75NTR Protein, Human, Recombinant
TMPS-00109-02 10 µg

NGFR/p75NTR Protein, Human, Recombinant

Sign In for Pricing
View Details