Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Substance-K receptor (Tacr2)

This Recombinant Rat Substance-K receptor (Tacr2) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

Substance-K receptor, SKR, NK-2 receptor, NK-2R, Neurokinin A receptor, Tachykinin receptor 2

UniProt

P16610

Expression Region

1-390

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTRAIVSDANILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILA HERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAIIAGIWLVALALASPQCFYSTITVDEGATK CVVAWPNDNGGKMLLLYHLVVFVLIYFLPLLVMFGAYSVIGLTLWKRAVPRHQAHGANLR HLQAKKKFVKAMVLVVLTFAICWLPYHLYFILGTFQEDIYYHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDRLELTHTPSLSRRVNRCHTKETLFMT GDMTHSEATNGQVGSPQDGEPAGPICKAQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM CF®820 Antibody Labeling Kit, 1x (20-50ug) labeling
#92432 1 Kit

Mix-n-StainTM CF®820 Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR560121 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
CD161 Mouse Monoclonal Antibody [A8E1]
HA601063 100 µL

CD161 Mouse Monoclonal Antibody [A8E1]

Sign In for Pricing
View Details
CHD7 Human Gene Knockout Kit (CRISPR)
KN221060 1 Kit

CHD7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C13orf7 (RNF219) Human Gene Knockout Kit (CRISPR)
KN416309 1 Kit

C13orf7 (RNF219) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PGP9.5 (UCHL1) Human Gene Knockout Kit (CRISPR)
KN401803 1 Kit

PGP9.5 (UCHL1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details