Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Substance-K receptor (Tacr2)

This Recombinant Rat Substance-K receptor (Tacr2) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

Substance-K receptor, SKR, NK-2 receptor, NK-2R, Neurokinin A receptor, Tachykinin receptor 2

UniProt

P16610

Expression Region

1-390

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTRAIVSDANILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILA HERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAIIAGIWLVALALASPQCFYSTITVDEGATK CVVAWPNDNGGKMLLLYHLVVFVLIYFLPLLVMFGAYSVIGLTLWKRAVPRHQAHGANLR HLQAKKKFVKAMVLVVLTFAICWLPYHLYFILGTFQEDIYYHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDRLELTHTPSLSRRVNRCHTKETLFMT GDMTHSEATNGQVGSPQDGEPAGPICKAQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrod2 (NM_028387) Mouse Tagged ORF Clone
MG200464 10 µg

Macrod2 (NM_028387) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Phospho C-Jun (Thr91, Thr93) (C-J 4C4/1), CF594 conjugate, 0.1mg/mL
BNC942282-500 1x 500 µL

Phospho C-Jun (Thr91, Thr93) (C-J 4C4/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant CENPA Antibody
RC-4374-01 50 μL

Recombinant CENPA Antibody

Sign In for Pricing
View Details
Recombinant CENPA Antibody
RC-4374-02 100 µL

Recombinant CENPA Antibody

Sign In for Pricing
View Details
Recombinant CENPA Antibody
RC-4374-03 1 mL

Recombinant CENPA Antibody

Sign In for Pricing
View Details
CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), 0.2mg/mL
BNUB2394-500 1x 500 µL

CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), 0.2mg/mL

Sign In for Pricing
View Details