Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Pan troglodytes 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin receptor 1B

UniProt

P60020

Expression Region

1-390

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL NSLINPIIYTMSNEDFKQAFHKLIRFKCTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (C5/473), 0.2mg/mL
BNUB0473-500 1x 500 µL

CD5 (C5/473), 0.2mg/mL

Sign In for Pricing
View Details
CD45RB (DF-B1), CF488A conjugate, 0.1mg/mL
BNC881066-500 1x 500 µL

CD45RB (DF-B1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tob2 Mouse Gene Knockout Kit (CRISPR)
KN518039 1 Kit

Tob2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP20 Human Gene Knockout Kit (CRISPR)
KN420786 1 Kit

MMP20 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2494), CF640R conjugate, 0.1mg/mL
BNC402494-500 1x 500 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2494), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Destriazolyl Bromo Propiconazole (Mixture of Diastereomers)
TRC-D297825-250MG 250 mg

Destriazolyl Bromo Propiconazole (Mixture of Diastereomers)

Sign In for Pricing
View Details