Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes 5-hydroxytryptamine receptor 1B (HTR1B)

This Recombinant Pan troglodytes 5-hydroxytryptamine receptor 1B (HTR1B) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1B, 5-HT-1B, 5-HT1B, Serotonin receptor 1B

UniProt

P60020

Expression Region

1-390

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL NSLINPIIYTMSNEDFKQAFHKLIRFKCTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRS2 (Ab-196) Antibody
8B8202-AAT 50 µg

FRS2 (Ab-196) Antibody

Sign In for Pricing
View Details
UNG Mouse Monoclonal Antibody [Clone ID: k1C12]
AM09040PU-S 50 µL

UNG Mouse Monoclonal Antibody [Clone ID: k1C12]

Sign In for Pricing
View Details
Metrizoic Acid
TRC-M338935-2G 2 g

Metrizoic Acid

Sign In for Pricing
View Details
MMP11 Mouse Monoclonal Antibody [Clone ID: 5ST-4A9]
AM21048PU-N 250 µg

MMP11 Mouse Monoclonal Antibody [Clone ID: 5ST-4A9]

Sign In for Pricing
View Details
p21 (CDKN1A) Human Gene Knockout Kit (CRISPR)
KN401765 1 Kit

p21 (CDKN1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1700028K03Rik Rabbit Polyclonal Antibody
TA374134 100 µL

1700028K03Rik Rabbit Polyclonal Antibody

Sign In for Pricing
View Details