Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Histamine H4 receptor (Hrh4)

This Recombinant Mouse Histamine H4 receptor (Hrh4) spans the amino acid sequence from region 1-391.

Product Specifications

Product Name Alternative

Histamine H4 receptor H4R HH4R

UniProt

Q91ZY2

Expression Region

1-391

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSESNSTGILPPAAQVPLAFLMSSFAFAIMVGNAVVILAFVVDRNLRHRSNYFFLNLAIS DFLVGLISIPLYIPHVLFNWNFGSGICMFWLITDYLLCTASVYNIVLISYDRYQSVSNAV SYRAQHTGIMKIVAQMVAVWILAFLVNGPMILASDSWKNSTNTKDCEPGFVTEWYILTIT MLLEFLLPVISVAYFNVQIYWSLWKRRALSRCPSHAGFSTTSSSASGHLHRAGVACRTSN PGLKESAASRHSESPRRKSSILVSLRTHMNSSITAFKVGSFWRSESAALRQREYAELLRG RKLARSLAILLSAFAICWAPYCLFTIVLSTYPRTERPKSVWYSIAFWLQWFNSFVNPFLY PLCHRRFQKAFWKILCVTKQPALSQNQSVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLCN6 antibody - C-terminal region (ARP35334_T100)
ARP35334_T100 100 µL

CLCN6 antibody - C-terminal region (ARP35334_T100)

Sign In for Pricing
View Details
DHRS3, ID (DHRS3, Short-chain dehydrogenase/reductase 3, DD83.1, Retinal short-chain dehydrogenase/reductase 1) (PE) discontinued
034619-PE 200 µL

DHRS3, ID (DHRS3, Short-chain dehydrogenase/reductase 3, DD83.1, Retinal short-chain dehydrogenase/reductase 1) (PE) discontinued

Sign In for Pricing
View Details
Interleukin 2 (IL-2) (MaxLight 490) discontinued
I7663-27F-ML490 100 µL

Interleukin 2 (IL-2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
HDAC4 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-2809R-BF555 100 µL

HDAC4 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
PMN-WATER-GR4-RLL090 Pipe Markers for Water
268772 220 Roll (220 Marker (s) x 1 Roll)

PMN-WATER-GR4-RLL090 Pipe Markers for Water

Sign In for Pricing
View Details
PGLYRP2 (PGLYRPL, PGRPL) discontinued
512705 100 µg

PGLYRP2 (PGLYRPL, PGRPL) discontinued

Sign In for Pricing
View Details