Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Somatostatin receptor type 1 (Sstr1)

This Recombinant Mouse Somatostatin receptor type 1 (Sstr1) spans the amino acid sequence from region 1-391.

Product Specifications

Product Name Alternative

Somatostatin receptor type 1, SS-1-R, SS1-R, SS1R, SRIF-2

UniProt

P30873

Expression Region

1-391

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFPNGTASSPSSSPSPSPGSCGEGACSRGPGSGAADGMEEPGRNASQNGTLSEGQGSAIL ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS RAYSVEDFQPENLESGGVFRNGTCASRISTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSRP2BP (KAT14) Human Gene Knockout Kit (CRISPR)
KN402620 1 Kit

CSRP2BP (KAT14) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C7orf50 activation kit by CRISPRa
GA113504 1 Kit

Human C7orf50 activation kit by CRISPRa

Sign In for Pricing
View Details
TTL Rabbit Polyclonal Antibody
ER2001-11 100 µL

TTL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HP1 alpha (CBX5) (NM_012117) Human Over-expression Lysate
LY402149 100 µg

HP1 alpha (CBX5) (NM_012117) Human Over-expression Lysate

Sign In for Pricing
View Details
MFI2 (MELTF) (NM_005929) Human Over-expression Lysate
LC401797 20 µg

MFI2 (MELTF) (NM_005929) Human Over-expression Lysate

Sign In for Pricing
View Details
Enzalutamide Carboxylic Acid
TRC-E559800-25MG 25 mg

Enzalutamide Carboxylic Acid

Sign In for Pricing
View Details