Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bombina orientalis [Phe13]-bombesin receptor (BB4)

This Recombinant Bombina orientalis [Phe13]-bombesin receptor (BB4) spans the amino acid sequence from region 1-392.

Product Specifications

Product Name Alternative

[Phe13]-bombesin receptor, Bombesin receptor subtype-4, BRS-4

UniProt

P47751

Expression Region

1-392

Origin

Bombina orientalis (Oriental fire-bellied toad)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPEGFQSLNQTLPSAISSIAHLESLNDSFILGAKQSEDVSPGLEILALISVTYAVIISVG ILGNTILIKVFFKIKSMQTVPNIFITSLAFGDLLLLLTCVPVDASRYIVDTWMFGRAGCK IISFIQLTSVGVSVFTLTVLSADRYRAIVKPLQLQTSDAVLKTCGKAVCVWIISMLLAAP EAVFSDLYEFGSSEKNTTFEACAPYPVSEKILQETHSLICFLVFYIVPLSIISAYYFLIA KTLYKSTFNMPAEEHTHARKQIESRKRVAKTVLVLVALFAVCWLPNHMLYLYRSFTYHSA VNSSAFHLSATIFARVLAFSNSCVNPFALYWLSRSFRQHFKKQVYCCKTEPPASQQSPTH SSTITGITAVKGNIQMSEISITLLSAYDVKKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-500 1x 500 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
BNC472216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
BNC040177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-500 1x 500 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF594 conjugate, 0.1mg/mL
BNC941707-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details