Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Corticotropin-releasing factor receptor 1 (Crhr1)

This Recombinant Mouse Corticotropin-releasing factor receptor 1 (Crhr1) spans the amino acid sequence from region 24-415.

Product Specifications

Product Name Alternative

Corticotropin-releasing factor receptor 1, CRF-R-1, CRF-R1, CRFR-1, Corticotropin-releasing hormone receptor 1, CRH-R-1

UniProt

P35347

Expression Region

24-415

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLQDQQCESLSLASNVSGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNG YRECLANGSWAARVNYSECQEILNEEKKSKVHYHIAVIINYLGHCISLVALLVAFVLFLR LRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQSNVAWCRLVTAAYNYFHVTNF FWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLYYDNEKCWFGKR PGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLL GITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQD KHSIRARVARAMSIPTSPTRVSFHSIKQSTAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCSD 1 (RCSD1) (NM_052862) Human Recombinant Protein
TP310933 20 µg

RCSD 1 (RCSD1) (NM_052862) Human Recombinant Protein

Sign In for Pricing
View Details
EGFR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E1]
TA802037BM 100 µL

EGFR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E1]

Sign In for Pricing
View Details
Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI3H3]
CF810154 100 µg

Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI3H3]

Sign In for Pricing
View Details
PCBP2 Human Knockdown Lysate
LY300264 100 µg

PCBP2 Human Knockdown Lysate

Sign In for Pricing
View Details
SLC12A3 Rabbit Polyclonal Antibody
TA367635 100 µL

SLC12A3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS636724 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details