Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Corticotropin-releasing factor receptor 1 (Crhr1)

This Recombinant Mouse Corticotropin-releasing factor receptor 1 (Crhr1) spans the amino acid sequence from region 24-415.

Product Specifications

Product Name Alternative

Corticotropin-releasing factor receptor 1, CRF-R-1, CRF-R1, CRFR-1, Corticotropin-releasing hormone receptor 1, CRH-R-1

UniProt

P35347

Expression Region

24-415

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLQDQQCESLSLASNVSGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNG YRECLANGSWAARVNYSECQEILNEEKKSKVHYHIAVIINYLGHCISLVALLVAFVLFLR LRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQSNVAWCRLVTAAYNYFHVTNF FWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLYYDNEKCWFGKR PGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLL GITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQD KHSIRARVARAMSIPTSPTRVSFHSIKQSTAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Suppressor of Ty 4 homolog 1 (SUPT4H1) (NM_003168) Human Over-expression Lysate
LY418857 100 µg

Suppressor of Ty 4 homolog 1 (SUPT4H1) (NM_003168) Human Over-expression Lysate

Sign In for Pricing
View Details
HSP90AA1 (NM_001017963) Human Over-expression Lysate
LC400399 20 µg

HSP90AA1 (NM_001017963) Human Over-expression Lysate

Sign In for Pricing
View Details
Human L2HGDH activation kit by CRISPRa
GA112746 1 Kit

Human L2HGDH activation kit by CRISPRa

Sign In for Pricing
View Details
MGP Goat Polyclonal Antibody
AP33335SU-S 20 µL

MGP Goat Polyclonal Antibody

Sign In for Pricing
View Details
CALM1 Rabbit Polyclonal Antibody
AP01351PU-N 100 µg

CALM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATP7A Rabbit Polyclonal Antibody
TA371269 100 µL

ATP7A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details