Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative odorant receptor 69a, isoform A (Or69a)

This Recombinant Drosophila melanogaster Putative odorant receptor 69a, isoform A (Or69a) spans the amino acid sequence from region 1-393.

Product Specifications

Product Name Alternative

Putative odorant receptor 69a, isoform A

UniProt

Q9VU27

Expression Region

1-393

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLHDHMKYIDLGCKMACIPRYQWKGRPTERQFYASEQRIVFLLGTICQIFQITGVLIYW YCNGRLATETGTFVAQLSEMCSSFCLTFVGFCNVYAISTNRNQIETLLEELHQIYPRYRK NHYRCQHYFDMAMTIMRIEFLFYMILYVYYNSAPLWVLLWEHLHEEYDLSFKTQTNTWFP WKVHGSALGFGMAVLSITVGSFVGVGFSIVTQNLICLLTFQLKLHYDGISSQLVSLDCRR PGAHKELSILIAHHSRILQLGDQVNDIMNFVFGSSLVGATIAICMSSVSIMLLDLASAFK YASGLVAFVLYNFVICYMGTEVTLASGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPY MWKTYKLAPVSITTYMATLKFSYQMFTCVRSLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-100 1x 100 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF594 conjugate, 0.1mg/mL
BNC941422-500 1x 500 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/795), CF488A conjugate, 0.1mg/mL
BNC880795-100 1x 100 µL

CD56 / NCAM (NCAM1/795), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details