Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative odorant receptor 69a, isoform B (Or69a)

This Recombinant Drosophila melanogaster Putative odorant receptor 69a, isoform B (Or69a) spans the amino acid sequence from region 1-393.

Product Specifications

Product Name Alternative

Putative odorant receptor 69a, isoform B

UniProt

P82985

Expression Region

1-393

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLEDFMRYPDLVCQAAQLPRYTWNGRRSLEVKRNLAKRIIFWLGAVNLVYHNIGCVMYG YFGDGRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLKTHFENLLNEFEELFQLIKH RAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQLGYRIQSNTWYP WQVQGSIPGFFAAVACQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARN PHAKDQLKYLIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLK HLLGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPY MWKTYKLAPVSITTYMATLKFSYQMFTCVRSLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-100 1x 100 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-100 1x 100 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details