Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Rabbit Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-394.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O77830

Expression Region

1-394

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNCKRTPRRIKCII LTVWLIAAAISLPPLIYKGDQGPQPHGAPQCKLNQEAWYILSSSLGSFFVPCLIMILVYL RIYLIAKRSHRRGPRAKGGPGEGESRQACPVPGGPSASAKLPTLATPVASASEANGPSKP AGEKEEGETPEDPGTQALPPGWATLPNSGQGQKEGVSGASLEEEAEEEEEEEEEEDEPQA VPVSPASVGSPPLQQPQGSRVLATLRGQVLVGRGVGAMSGQWWRRRAQLSREKRFTFVLA VVIGVFVLCWFPFFFSYSLSAICPQQCRVPHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GABA Receptor Epsilon Antibody [DyLight 680]
NBP2-97158FR 0.1 mL

Rabbit Polyclonal GABA Receptor Epsilon Antibody [DyLight 680]

Sign In for Pricing
View Details
TSN Peptide - middle region
MBS3246312-01 0.1 mg

TSN Peptide - middle region

Sign In for Pricing
View Details
TSN Peptide - middle region
MBS3246312-02 5x 0.1 mg

TSN Peptide - middle region

Sign In for Pricing
View Details
Mapk13, CT (Mapk13, Serk4, Mitogen-activated protein kinase 13, Mitogen-activated protein kinase p38 delta, Stress-activated protein kinase 4) (MaxLight 750) discontinued
038169-ML750 100 µL

Mapk13, CT (Mapk13, Serk4, Mitogen-activated protein kinase 13, Mitogen-activated protein kinase p38 delta, Stress-activated protein kinase 4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-MMP9 Rabbit Monoclonal Antibody
MA3749-.1 100 µL

Anti-MMP9 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Hba1 (NM_013096) Rat Untagged Clone
RN201010 10 µg

Hba1 (NM_013096) Rat Untagged Clone

Sign In for Pricing
View Details