Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Rabbit Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-394.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O77830

Expression Region

1-394

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNCKRTPRRIKCII LTVWLIAAAISLPPLIYKGDQGPQPHGAPQCKLNQEAWYILSSSLGSFFVPCLIMILVYL RIYLIAKRSHRRGPRAKGGPGEGESRQACPVPGGPSASAKLPTLATPVASASEANGPSKP AGEKEEGETPEDPGTQALPPGWATLPNSGQGQKEGVSGASLEEEAEEEEEEEEEEDEPQA VPVSPASVGSPPLQQPQGSRVLATLRGQVLVGRGVGAMSGQWWRRRAQLSREKRFTFVLA VVIGVFVLCWFPFFFSYSLSAICPQQCRVPHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lect1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3812202 1.0 µg DNA

Lect1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
SLAMF1 Human
32-13430-2 2 µg

SLAMF1 Human

Sign In for Pricing
View Details
Lentiviral human KRT83 sgRNA gene knockout kit - Lentiviral human KRT83 sgRNA gene knockout kit (25)
GTR15375123 1 Vial

Lentiviral human KRT83 sgRNA gene knockout kit - Lentiviral human KRT83 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
MOG Protein Lysate (Mouse) with C-HA Tag
30299034 100 µg

MOG Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C800.13 (SPBC800.13)
MBS1318479-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C800.13 (SPBC800.13)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C800.13 (SPBC800.13)
MBS1318479-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C800.13 (SPBC800.13)

Sign In for Pricing
View Details