Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Rabbit Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-394.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O77830

Expression Region

1-394

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNCKRTPRRIKCII LTVWLIAAAISLPPLIYKGDQGPQPHGAPQCKLNQEAWYILSSSLGSFFVPCLIMILVYL RIYLIAKRSHRRGPRAKGGPGEGESRQACPVPGGPSASAKLPTLATPVASASEANGPSKP AGEKEEGETPEDPGTQALPPGWATLPNSGQGQKEGVSGASLEEEAEEEEEEEEEEDEPQA VPVSPASVGSPPLQQPQGSRVLATLRGQVLVGRGVGAMSGQWWRRRAQLSREKRFTFVLA VVIGVFVLCWFPFFFSYSLSAICPQQCRVPHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDZ domain-containing Protein 11 (HRP)
327829-01 50 µg

PDZ domain-containing Protein 11 (HRP)

Sign In for Pricing
View Details
PDZ domain-containing Protein 11 (HRP)
327829-02 100 µg

PDZ domain-containing Protein 11 (HRP)

Sign In for Pricing
View Details
Human IRAK2 knockout cell line
ABC-KH7462 1 Vial

Human IRAK2 knockout cell line

Sign In for Pricing
View Details
Fibulin 5 Recombinant Antibody, HRP Conjugated
bsm-61521R-HRP-01 20 µL

Fibulin 5 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Fibulin 5 Recombinant Antibody, HRP Conjugated
bsm-61521R-HRP-02 100 µL

Fibulin 5 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
UGCG Rabbit Polyclonal Antibody
orb214716-01 30 µL

UGCG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details