Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma genitalium Uncharacterized protein MG443 (MG443)

This Recombinant Mycoplasma genitalium Uncharacterized protein MG443 (MG443) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

Uncharacterized protein MG443

UniProt

P47681

Expression Region

1-395

Origin

Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFFNNLFKKESKITVASGSKRVRISNSFLMFSNLYEAKKPLKYVLVYLLSIINAFLLLI FIQKTGLYSFGISSLTQGFARLVFVLLKSFDETQRLLIFNILYWLLYVFINIPLIIFSYK KIGKNFTILSTHFVVASNVFGFLISIIPGSDNLPPMLASITDTNFWKAAKDLNQSAGFVP FLWSDTSQGNVIISTFIYAAIYGFYNGISVSLLYILGGSAGGADFLTQYYARKKNRSVGS ILFYVNSFILIIAILIGSFVAGSLLLQDVNNYRDSAWEVSLFFSPNLIATFFSILLTGTV VSYLFPRYNFAEIKVFTDKLEEVRKALLSDNANHSLSIQETLGGYSLLKKKMIVSVSMYV EIPHLIKIIRQIDKDCLVSITRIRGIDGHIYLRQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-100 1x 100 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-100 1x 100 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF488A conjugate, 0.1mg/mL
BNC882408-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF594 conjugate, 0.1mg/mL
BNC942227-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 3 (M3.1), CF647 conjugate, 0.1mg/mL
BNC470990-100 1x 100 µL

Mucin 3 (M3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details