Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 182 (Gpr182)

This Recombinant Mouse G-protein coupled receptor 182 (Gpr182) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

G-protein coupled receptor 182, G10D, NOW

UniProt

P43142

Expression Region

1-395

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVIPSPRPVSTLEPDNDFRDIHNWTELLHLFNQTFTDCHIEFNENTKHVVLFVFYLAIF VVGLVENVLVICVNCRRSGRVGMLNLYILNMAIADLGIILSLPVWMLEVMLEYTWLWGSF SCRFIHYFYLVNMYSSIFFLTCLSIDRYVTLTNTSPSWQRHQHRIRRAVCAGVWVLSAII PLPEVVHIQLLDGSEPMCLFLAPFETYSAWALAVALSATILGFLLPFLLIAVFNILTACR LRRQRQTESRRHCLLMWAYIVVFAICWLPYQVTMLLLTLHGTHIFLHCHLVNLLYFFYEI IDCFSMLHCVANPILYNFLSPSFRGRLLSLVVRYLPKEQARAAGGRASSSSSTQHSIIIT KEGSLPLQRISTPTPSETFRRPLRLQTPHLHSAIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Carbohydrate Sulfotransferase 15 (CHST15) Protein
abx693270 50 µg

Human Carbohydrate Sulfotransferase 15 (CHST15) Protein

Sign In for Pricing
View Details
GSK2795039 5mg
A20998-5 5 mg

GSK2795039 5mg

Sign In for Pricing
View Details
Sheep membrane type 1 matrix metalloproteinase
GTR10420035 96 Well

Sheep membrane type 1 matrix metalloproteinase

Sign In for Pricing
View Details
Std Filter Paper Discs Gr A - 270mm
SLS2037 100 / PCK

Std Filter Paper Discs Gr A - 270mm

Sign In for Pricing
View Details
Oxethazaine 200mg
A17367-200 200 mg

Oxethazaine 200mg

Sign In for Pricing
View Details
Rabbit Polyclonal SPICE1 Antibody [DyLight 755]
NBP2-97999IR 0.1 mL

Rabbit Polyclonal SPICE1 Antibody [DyLight 755]

Sign In for Pricing
View Details