Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 182 (Gpr182)

This Recombinant Mouse G-protein coupled receptor 182 (Gpr182) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

G-protein coupled receptor 182, G10D, NOW

UniProt

P43142

Expression Region

1-395

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVIPSPRPVSTLEPDNDFRDIHNWTELLHLFNQTFTDCHIEFNENTKHVVLFVFYLAIF VVGLVENVLVICVNCRRSGRVGMLNLYILNMAIADLGIILSLPVWMLEVMLEYTWLWGSF SCRFIHYFYLVNMYSSIFFLTCLSIDRYVTLTNTSPSWQRHQHRIRRAVCAGVWVLSAII PLPEVVHIQLLDGSEPMCLFLAPFETYSAWALAVALSATILGFLLPFLLIAVFNILTACR LRRQRQTESRRHCLLMWAYIVVFAICWLPYQVTMLLLTLHGTHIFLHCHLVNLLYFFYEI IDCFSMLHCVANPILYNFLSPSFRGRLLSLVVRYLPKEQARAAGGRASSSSSTQHSIIIT KEGSLPLQRISTPTPSETFRRPLRLQTPHLHSAIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRT-060318 2mg
A15524-2 2 mg

PRT-060318 2mg

Sign In for Pricing
View Details
SF3B2 (Splicing Factor 3B Subunit 2, Pre-mRNA-splicing Factor SF3b 145kD Subunit, SF3b145, SF3b150, Spliceosome-associated Protein 145, SAP 145, SAP145) (MaxLight 550)
133217-ML550 100 µL

SF3B2 (Splicing Factor 3B Subunit 2, Pre-mRNA-splicing Factor SF3b 145kD Subunit, SF3b145, SF3b150, Spliceosome-associated Protein 145, SAP 145, SAP145) (MaxLight 550)

Sign In for Pricing
View Details
Signaltides™ - SUN1 HL-14-R
081-25 500 µg

Signaltides™ - SUN1 HL-14-R

Sign In for Pricing
View Details
METTL18 Rabbit Polyclonal Antibody (Carrier-free)
orb3093020 100 µg

METTL18 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
SLC25A46 Antibody
CSB-PA856895LA01HU-01 50 µg

SLC25A46 Antibody

Sign In for Pricing
View Details
SLC25A46 Antibody
CSB-PA856895LA01HU-02 100 µg

SLC25A46 Antibody

Sign In for Pricing
View Details