Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Manduca sexta Diuretic hormone receptor

This Recombinant Manduca sexta Diuretic hormone receptor spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

Diuretic hormone receptor, DH-R

UniProt

P35464

Expression Region

1-395

Origin

Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEECLARKFNLSDNYCPAYFDGLLCWDPTPWNTLAVQKCFKELYGIQYDDTQNASRLCL DGVWHNYTNYTNCTERIANGSPTDVASLIYLAGYSLSLAVLSLAVFVFLYFKDLRCLRNT IHTNLMSTYILSACSWILNLVLQNWSDESQQDQTSCMILVICMNYFYLTNFFWMLVEGLY LYMLVVETFTAENIKLKVYTTIGWGAPAVFITIWVISRCFVNVLPSTGPDGLAMFPEAKM CIWMHEHQVDWIHKAPALVGLALNLFFLIRIMWVLITKLRSANTLETEQYRKATKALLVL IPLLGITNLLVLCGPSDDSWFAYAFDYTRALMLSTQGFTVALFYCFMNTEVRHAIRYHVE RWKTGRTIGGGRRRGASYSKDWSPRSRTESIRLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CCL3/MIP-1 alpha, Tag Free
HA211056-01 Inquire

Rat CCL3/MIP-1 alpha, Tag Free

Sign In for Pricing
View Details
Rat CCL3/MIP-1 alpha, Tag Free
HA211056-02 50 µg

Rat CCL3/MIP-1 alpha, Tag Free

Sign In for Pricing
View Details
Rat CCL3/MIP-1 alpha, Tag Free
HA211056-03 100 µg

Rat CCL3/MIP-1 alpha, Tag Free

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF568 conjugate, 0.1mg/mL
BNC682554-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alpha-Ecdysone ( >90%)
TRC-E325100-0.5MG 0.5 mg

Alpha-Ecdysone ( >90%)

Sign In for Pricing
View Details
Human IRTA2 (FCRL5) activation kit by CRISPRa
GA113162 1 Kit

Human IRTA2 (FCRL5) activation kit by CRISPRa

Sign In for Pricing
View Details