Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 84 (Gpr84)

This Recombinant Mouse G-protein coupled receptor 84 (Gpr84) spans the amino acid sequence from region 1-396.

Product Specifications

Product Name Alternative

G-protein coupled receptor 84

UniProt

Q8CIM5

Expression Region

1-396

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWNSSDANFSCYHESVLGYRYFAVIWGVAVAVTGTVGNVLTLLALAIRPKLRTRFNLLIA NLTLADLLYCTLLQPFSVDTYLHLHWRTGAVFCRIFGLLLFTSNSVSILTLCLIALGRYL LIAHPKLFPQVFSAKGIVLALVGSWVVGVTSFAPLWNVFVLVPVVCTCSFDRMRGRPYTT ILMGIYFVLGLSSVGVFYCLIHRQVKRAARALDQYGLHQASIRSHQVAGTQEAMPGHFQE LDSGVASRGPSEGISSEPVSAATTQTLEGDSSEAGGQGIRKAAQQIAERSLPEVHRKPRE TAGARRATDAPSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARGRAPRVVHMVAANLTW LNSCINPVLYAAMNRQFRHAYGSILKRGPQSFRRFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Thyroid gland
CS712857 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
MMP2 (NM_001127891) Human Recombinant Protein
TP720324XL 1 mg

MMP2 (NM_001127891) Human Recombinant Protein

Sign In for Pricing
View Details
GPIP137 (CAPRIN1) (C-term) Rabbit Polyclonal Antibody
AP12211PU-N 400 µL

GPIP137 (CAPRIN1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERK2 Mouse Monoclonal Antibody [5-D2]
M1407-3 100 µL

ERK2 Mouse Monoclonal Antibody [5-D2]

Sign In for Pricing
View Details
TSNARE1 Human Gene Knockout Kit (CRISPR)
KN422993 1 Kit

TSNARE1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Smarcal1 Mouse Gene Knockout Kit (CRISPR)
KN516286 1 Kit

Smarcal1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details