Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 84 (Gpr84)

This Recombinant Mouse G-protein coupled receptor 84 (Gpr84) spans the amino acid sequence from region 1-396.

Product Specifications

Product Name Alternative

G-protein coupled receptor 84

UniProt

Q8CIM5

Expression Region

1-396

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWNSSDANFSCYHESVLGYRYFAVIWGVAVAVTGTVGNVLTLLALAIRPKLRTRFNLLIA NLTLADLLYCTLLQPFSVDTYLHLHWRTGAVFCRIFGLLLFTSNSVSILTLCLIALGRYL LIAHPKLFPQVFSAKGIVLALVGSWVVGVTSFAPLWNVFVLVPVVCTCSFDRMRGRPYTT ILMGIYFVLGLSSVGVFYCLIHRQVKRAARALDQYGLHQASIRSHQVAGTQEAMPGHFQE LDSGVASRGPSEGISSEPVSAATTQTLEGDSSEAGGQGIRKAAQQIAERSLPEVHRKPRE TAGARRATDAPSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARGRAPRVVHMVAANLTW LNSCINPVLYAAMNRQFRHAYGSILKRGPQSFRRFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Znrf3 Mouse Gene Knockout Kit (CRISPR)
KN520131 1 Kit

Znrf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD41 (ITGA2B) Human Gene Knockout Kit (CRISPR)
KN422614 1 Kit

CD41 (ITGA2B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NCOA1 Rabbit Monoclonal Antibody [Clone ID: R07-5B7]
TA421965 100 µL

NCOA1 Rabbit Monoclonal Antibody [Clone ID: R07-5B7]

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/795), CF405S conjugate, 0.1mg/mL
BNC040795-500 1x 500 µL

CD56 / NCAM (NCAM1/795), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COG7 (NM_153603) Human Recombinant Protein
TP307130L 1 mg

COG7 (NM_153603) Human Recombinant Protein

Sign In for Pricing
View Details
RANBP6 Rabbit Polyclonal Antibody
TA380701 100 µL

RANBP6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details