Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 84 (GPR84)

This Recombinant Human G-protein coupled receptor 84 (GPR84) spans the amino acid sequence from region 1-396.

Product Specifications

Product Name Alternative

G-protein coupled receptor 84, Inflammation-related G-protein coupled receptor EX33

UniProt

Q9NQS5

Expression Region

1-396

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIA NLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYL LIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTT ILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQE LDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQP IKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTW LNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB3IP (NM_001024647) Human Over-expression Lysate
LY422524 100 µg

RAB3IP (NM_001024647) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Acetyl-cys(1)-calcitonin Salmon Trifluoroacetic Acid Salt
TRC-A168465-25MG 25 mg

N-Acetyl-cys(1)-calcitonin Salmon Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
SNAP25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B2]
TA502968AM 100 µL

SNAP25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B2]

Sign In for Pricing
View Details
Hsp40 (DNAJB1) (1-340) Mouse Monoclonal Antibody [Clone ID: k1C7]
AM05642PU-S 50 µL

Hsp40 (DNAJB1) (1-340) Mouse Monoclonal Antibody [Clone ID: k1C7]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Tubulin,  15nm
GM-35-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Tubulin, 15nm

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF594 conjugate, 0.1mg/mL
BNC941532-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details