Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Cell division topological determinant MinJ (minJ)

This Recombinant Bacillus subtilis Cell division topological determinant MinJ (minJ) spans the amino acid sequence from region 1-397.

Product Specifications

Product Name Alternative

Cell division topological determinant MinJ

UniProt

O34375

Expression Region

1-397

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVQWGIELLKSAGLFFLHPLFWFFIIITLAFGYVRIKRERKTFHTRIADIYDDLKFTYT KGLIPGLLLSVILGGLGISIPLGLLAIIAVITAAAAFTLRANWMSAAYIVSVSMLIGFGL QIYQAEPFLERFPQGFAVVWPAVAVFLGLLIITEGAVAYRSAHVRTSPALVVSSRGLPIG QQLANRVWLLPLFLLVPGNGLESHLSWWPVFTVPGGSFHFLWIPYFVGFGQRVQGSLPET SIRITAKRVCILGLAVAVLGAASLLWTPLAGAAVCTALLGRIFLSIKQRVNDNAAPFYFS KRDQGLMVLGIIPNTPAEDLELKIGEIITKVNGIPVKNVSDFYEALQHNRAYVKLEIIGL NGEIRFDQRASYEGEHHELGILFVKDDREDEAVASGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Ebi3 Protein (Trx Tag)
PDEM100134-01 20 µg

Recombinant Mouse Ebi3 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ebi3 Protein (Trx Tag)
PDEM100134-02 100 µg

Recombinant Mouse Ebi3 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ebi3 Protein (Trx Tag)
PDEM100134-03 500 µg

Recombinant Mouse Ebi3 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ebi3 Protein (Trx Tag)
PDEM100134-04 1 mg

Recombinant Mouse Ebi3 Protein (Trx Tag)

Sign In for Pricing
View Details
IKB alpha (NFKBIA) Rabbit Polyclonal Antibody
AP02651PU-S 50 µL

IKB alpha (NFKBIA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL2 Canine
OM296428-01 1 µg

IL2 Canine

Sign In for Pricing
View Details