Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Octopus vulgaris Cephalotocin receptor 1 (CTR1)

This Recombinant Octopus vulgaris Cephalotocin receptor 1 (CTR1) spans the amino acid sequence from region 1-397.

Product Specifications

Product Name Alternative

Cephalotocin receptor 1, OC/CE-R 1, OT/VP superfamily peptide receptor 1

UniProt

Q7YW31

Expression Region

1-397

Origin

Octopus vulgaris (Common octopus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRYITTHPNEISTQIWNNFSSTEIWSNFSAAKNETQPIRRNQDLANAEVITLAVVIIITV IGNSIVLITLFQRRKKLTRMHLFILHLSVTDLFVAFFNNLPQMIWDITFLFLGTDLLCRL VTYLQSVAMYASSYVLVATAIDRYFAICHPLSSHKWTTARVHVMVFIAWMLSFLFSTPQL FIWSMQFSNIGLTCQATFDPEWTLKFYITWLTVAIWILPTIALTLFYGMMCFAVWKRGRS TLGSSRTRNRSFLTNRVSTRIGQSHLARGFSEEDMEGQSVNYNRGISRAKVRSVALTLSV VACCFICWSPFFVCQMWAAWDENAPYSGAIYTILLLLSSLNSCTNPWIYMIFSVFQHRAK TSRFVNDEETTSVTVLSSRNDIRLMSMKKKLEQTARN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-500 1x 500 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-100 1x 100 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-500 1x 500 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-100 1x 100 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details