Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative gustatory receptor 85a (Gr85a)

This Recombinant Drosophila melanogaster Putative gustatory receptor 85a (Gr85a) spans the amino acid sequence from region 1-397.

Product Specifications

Product Name Alternative

Putative gustatory receptor 85a

UniProt

Q8INM9

Expression Region

1-397

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSLIEAQLLGGKLVNRVMASLRRIIQRSLGYFCALNGILDFNTDIGTGNLRRYRVLFMY RLLHNFAVISLTLKFLFDFTDHFKYIESSTLITVNFFTYFTLVFFALLSSMGSCYQWQNR ILAVLKELKHQRDLSRHMGYRVPRSKQNSIDYLLFALTVLLILRLSIHLATFTLSARMGF NHPCNCFLPECMIFSMNYLLFAILAEITRCWWSLQSGLKMVLLNRQLSTVAFNLWEIERL HTRFQCLIDLTSEVCSIFRYVTLAYMARNLWSGIVAGYLLVRFVIGNGLQDVELVYLVFS FITCIQPLMLSLLVNSMTSTTGSLVEVTRDILKISHKKSVNLERSIEWLSLQLTWQHTHV TIFGVFRINRSLAFRSASLILVHVLYMVQSDYISITN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL
BNC940008-500 1x 500 µL

MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-100 1x 100 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details