Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Talpa europaea Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Talpa europaea Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-397.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O19091

Expression Region

1-397

Origin

Talpa europaea (European mole)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAIIIFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRRMWCKVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCII LMVWLIAAVISLPSLVYKGDQGPQPSGAPQCNLNQETWYILASSIGSFFAPCLIMILVYL RIYLIAKRSHCRGPRAKGAPGKSKFKQSRQVPGGTLASAKVPNLAAHLVAAGETNGRSKP TGEKEMGETPEDSGTSTLPPSWPALPNSGQDQKEGICEASLEEEAEEEEEGEEEREEECE PQALPASPASACSPPLQQPQGSQVLATLRGQVLLGRAAGAASGQWWRRRTQLSREKRFTF VLAVVIGVFVLCWFPFFFSYSLGAICPQQCKVPHDLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-100 1x 100 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-500 1x 500 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSA (Prostate Specific Antigen) (KLK3/801), CF647 conjugate, 0.1mg/mL
BNC470801-500 1x 500 µL

PSA (Prostate Specific Antigen) (KLK3/801), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNA Ligase 1 (1A9), CF740 conjugate, 0.1mg/mL
BNC742177-500 1x 500 µL

DNA Ligase 1 (1A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (2F6), CF568 conjugate, 0.1mg/mL
BNC681014-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (2F6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details