Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Odorant receptor 59a (Or59a)

This Recombinant Drosophila melanogaster Odorant receptor 59a (Or59a) spans the amino acid sequence from region 1-397.

Product Specifications

Product Name Alternative

Odorant receptor 59a

UniProt

P81923

Expression Region

1-397

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEVRVDSLEFFKSHWTAWRYLGVAHFRVENWKNLYVFYSIVSNLLVTLCYPVHLGISLF RNRTITEDILNLTTFATCTACSVKCLLYAYNIKDVLEMERLLRLLDERVVGPEQRSIYGQ VRVQLRNVLYVFIGIYMPCALFAELSFLFKEERGLMYPAWFPFDWLHSTRNYYIANAYQI VGISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEVGLDPARDAEKDLEACITDHKHI LEWAGGSLVRVLFTFQLFSRLFRRIEAFISLPMLIQFTVTALNVCIGLAALVFFVSEPMA RMYFIFYSLAMPLQIFPSCFFGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSL KKSTAVAGGMMRIHLDTFFSTLKGAYSLFTIIIRMRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF488A conjugate, 0.1mg/mL
BNC880193-100 1x 100 µL

CD86 (BU63), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (9E10.3), CF770 conjugate, 0.1mg/mL
BNC700596-500 1x 500 µL

C-Myc (9E10.3), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL
BNC402337-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF568 conjugate, 0.1mg/mL
BNC681986-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details