Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Bombesin receptor subtype-3 (BRS3)

This Recombinant Macaca mulatta Bombesin receptor subtype-3 (BRS3) spans the amino acid sequence from region 1-398.

Product Specifications

Product Name Alternative

Bombesin receptor subtype-3, BRS-3

UniProt

Q6H2Y3

Expression Region

1-398

Origin

Macaca mulatta (Rhesus macaque)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQRQPHSPNQTLISITNDTESSSVVSNDNTNKGRSGDNSPGIEALCAIYITYAVIISVG ILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCK VLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCIKAGCVWIVSMIFALP EAIFSNVYSFRDPNKNVTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLIA RTLYKSTLNIPTEEQGHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQTY VDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKTFQKHFKAQLFCCKAEQPEPPVADTS LTTLAVMGRVPGTGNMQMSEISVTSFPGCSVKQAEDRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEPTOR (E-2) : m-IgG Fc BP-HRP Bundle
sc-538671 1 Kit

DEPTOR (E-2) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
BioE-1115 10mg
A22301-10 10 mg

BioE-1115 10mg

Sign In for Pricing
View Details
rno-miR-133a-5p miRNA Antagomir
MNR01095 2x 5.0 nmol

rno-miR-133a-5p miRNA Antagomir

Sign In for Pricing
View Details
CASC3 Protein Vector (Human) (pPB-C-His)
PV007525 500 ng

CASC3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Phospho-IKK beta (Ser476) Polyclonal Antibody, Cy3 Conjugated
bs-5442R-Cy3 100 µL

Phospho-IKK beta (Ser476) Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
IFNB1 Rabbit Polyclonal Antibody (BF555)
orb2443781 100 µL

IFNB1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details