Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Bombesin receptor subtype-3 (BRS3)

This Recombinant Macaca mulatta Bombesin receptor subtype-3 (BRS3) spans the amino acid sequence from region 1-398.

Product Specifications

Product Name Alternative

Bombesin receptor subtype-3, BRS-3

UniProt

Q6H2Y3

Expression Region

1-398

Origin

Macaca mulatta (Rhesus macaque)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQRQPHSPNQTLISITNDTESSSVVSNDNTNKGRSGDNSPGIEALCAIYITYAVIISVG ILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCK VLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCIKAGCVWIVSMIFALP EAIFSNVYSFRDPNKNVTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLIA RTLYKSTLNIPTEEQGHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQTY VDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKTFQKHFKAQLFCCKAEQPEPPVADTS LTTLAVMGRVPGTGNMQMSEISVTSFPGCSVKQAEDRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AADAC Rabbit pAb
E45R17989N-50 50 µL

AADAC Rabbit pAb

Sign In for Pricing
View Details
XRCC1 Mouse Monoclonal Antibody [Clone:2G8]
E45M09511 100 µg

XRCC1 Mouse Monoclonal Antibody [Clone:2G8]

Sign In for Pricing
View Details
THA1 shRNA Plasmid (m)
sc-154242-SH 20 µg

THA1 shRNA Plasmid (m)

Sign In for Pricing
View Details
TTTY3B sgRNA CRISPR Lentivector (Human) (Target 3)
K2554004 1.0 µg DNA

TTTY3B sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-human Galectin-3 mAb (Gal-3), unconjugated
orb1291440 1 mg

Anti-human Galectin-3 mAb (Gal-3), unconjugated

Sign In for Pricing
View Details
GTP Binding Protein 1 (GTPBP1) Antibody (HRP)
abx335901-01 20 µg

GTP Binding Protein 1 (GTPBP1) Antibody (HRP)

Sign In for Pricing
View Details